PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 546aa    MW: 60787.8 Da    PI: 5.6926
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902629.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.44e-1361785463374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      +L +cA+a++++d+  +++l+++l++++s +g+p+qRl ay++e+L arla+s+s++ykal+++e +    +e l++++l++ev+P++kf+++ 
  XP_015902629.1 178 GVLCACAKALADNDMVTTEWLITELRQMVSVSGEPLQRLGAYILEGLVARLASSGSSIYKALRCKEPA---GAELLSYMHLLYEVCPYFKFGYMS 269
                     689****************************************************************9...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI eav+ e++vHiiDf+i qG+QW+ L++aLa+Rp+gpp++RiTg+++++s   +   l  +g+rL+++A++++vpfef+  v  + ++++
  XP_015902629.1 270 ANGAIAEAVKDESMVHIIDFQIAQGTQWIILIHALATRPGGPPRIRITGIDDSTSAyaRGGGLDVVGQRLSSIAKSCKVPFEFHG-VGISGSEVQ 363
                     ****************************************************998899999************************.68899**** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     le+Lr++pgEalaVn++l+lh+++desvs++++rd++L+lvkslsPkvv++veqe+++n+++F+ r+le+l+yy+a+f+s+++ +pr+++eri+v
  XP_015902629.1 364 LEDLRIQPGEALAVNFALMLHHMPDESVSSQNHRDRLLRLVKSLSPKVVTLVEQECNTNTAPFFPRVLETLNYYMAVFESIDVAMPRDKRERISV 458
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E+++l+reivn++acegaer+erhe l+kWr+r+++aG++p+pls+ +++++k+ll++++++ +++ee++g+l+lgW++++Lv+ +aWr
  XP_015902629.1 459 EQHCLAREIVNIIACEGAERVERHEPLGKWRSRFMMAGYTPYPLSSIVNATIKALLKNYSEN-FTLEERDGALYLGWMNKALVTSCAWR 546
                     ************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.103150527IPR005202Transcription factor GRAS
PfamPF035141.4E-133178546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MHTSKNHRIP NCSHKSFEQS VEEPESYYWP PIQNLEHRTS SDEVSQGIHL SAHAFGQYCT  60
LESSSKTNCN PVHNTSSSVS FSSDGSPESQ QDAQSYPLDK HYYPDNACAS PPSQSCLTDD  120
IDDLRHKIRE LETAMLGTDS EILDTFTVTN EVGSYAQSLQ AESWRQIAEM ITRGDLKGVL  180
CACAKALADN DMVTTEWLIT ELRQMVSVSG EPLQRLGAYI LEGLVARLAS SGSSIYKALR  240
CKEPAGAELL SYMHLLYEVC PYFKFGYMSA NGAIAEAVKD ESMVHIIDFQ IAQGTQWIIL  300
IHALATRPGG PPRIRITGID DSTSAYARGG GLDVVGQRLS SIAKSCKVPF EFHGVGISGS  360
EVQLEDLRIQ PGEALAVNFA LMLHHMPDES VSSQNHRDRL LRLVKSLSPK VVTLVEQECN  420
TNTAPFFPRV LETLNYYMAV FESIDVAMPR DKRERISVEQ HCLAREIVNI IACEGAERVE  480
RHEPLGKWRS RFMMAGYTPY PLSSIVNATI KALLKNYSEN FTLEERDGAL YLGWMNKALV  540
TSCAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-641805468375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902629.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015902630.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015902631.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015902632.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLW9R3X90.0W9R3X9_9R
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein